DPCstruct | MC25077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R4IJF7 | 406-522 | EQNLQKYTKLLLSGRKKEALESAMQSGLWGHALFLASKMDSRSYNTVLSRFTGSLTPSDPLQTLFQLLSGRIPAVSMSWSSEKWGDW… |
| A0A6J1W793 | 1-145 | MPEESGEAQLSFLTDSLIATIDSLEKETERFRELLLYGRKKDALESAMKHGLWGHALLLASKMDSRTHARVMTRFANSLPINDPLQT… |
| A0A4W4DXJ8 | 209-325 | None |
| A0A3Q0JKW5 | 1-144 | None |
| A0A131YY82 | 68-206 | None |
| A0A6P4K1P1 | 206-340 | None |
| H9GJ81 | 245-389 | None |
| H3B7X7 | 5-137 | None |
| A0A3B3ZLZ3 | 225-370 | None |
| A0A2S2NCZ8 | 28-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.