DPCstruct | MC25074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 248 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1W510 | 1-232 | RASFALDRDAKKKLRLALCSADSVALPVLSHSTRNGLPDHTDPEDNEIVCFLKIQLAEAINLQDKNLMAQLQETMRCVGRFDNRTCR… |
| A0A016WVA2 | 231-466 | YYSAENLTNCRAFLDAKRKLRLVLSSVGNILTMPMDGPCRGIKLENEREQLVLLLRTLLAEAVNGREQGLVAHTREVIRCLQIFDNK… |
| A0A183U3L9 | 15-280 | None |
| A0A044SH27 | 1202-1445 | None |
| A0A1I8B0V0 | 882-1140 | None |
| A0A814C2P2 | 122-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.