DPCstruct | MC25070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.81 |
| Pfam Score | 94.07 |
| Assigned Pfam label(s) | PF08150- PF08165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3ID79 | 414-529 | RKISKFGTEARQLKAGIKSVEDTEKVLEAMKKSKQMLKKVKDISEEPQHSIPDVFIWMIVDKKRIAYCRIDSKTILHSAAEEEMGRY… |
| A0A6J1W450 | 28-153 | NQMVQAALKMKHEDSDLQMVLDQAEDWLSRLKSMVEEPQNSLPDVVIWMLQGDRRVAYARLPAREVLFSRNGVSCCGKNCGRLQTIF… |
| A0A6I9YM73 | 5-131 | None |
| A0A6S7HPN9 | 259-387 | None |
| A0A5N4CU03 | 48-208 | None |
| A0A1Y1N5R3 | 170-297 | None |
| A0A6F9CDF5 | 75-208 | None |
| A0A3P7FCT4 | 667-807 | None |
| A0A3L8DKQ7 | 175-309 | None |
| A0A2G9RM83 | 10-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.