DPCstruct | MC25068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060WL26 | 17-162 | GRAFAEPELKFVEEPYKKPMLKFFDISRGKASAGELLAAFELIELDYSSFGEPSLPADVYPREPEYLKEEKYYIIPDGVRPVLKKFR… |
| A0A0S7J656 | 6-126 | RLLWHPVIQKGQRSGEALVAAELILKDKSGEGDLPLVPPKRAENLYMVPQGIRPVVQLTAVEILAWGLRNMKTYQLAAVSSPSLVVE… |
| A0A814TZJ9 | 72-212 | None |
| F1KY85 | 64-202 | None |
| A0A218U7M5 | 24-148 | None |
| A0A7R5KEF8 | 1-149 | None |
| A0A820L9N1 | 1-75 | None |
| A0A815TK50 | 67-210 | None |
| G3PC45 | 89-234 | None |
| A0A6F9CDF5 | 291-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.