DPCstruct | MC25064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1W0X7 | 2-132 | QLLLGFQSIVGHCCPPHEDGGIVHCALKAPQFLVSDREFPGSTRLLLKRSTFCPIKHLTAEQRASLPTETRHQGVDVGVAVLLESAN… |
| A0A6P5LLX7 | 3-134 | QARVLLLLSGLWEPVGFARSVCGLLGLGPGPGPWRVYCGLERGRLLLSDRSFSGATAQLPLQRSRFCPFWALEQRPPGAAGPKQPPD… |
| A0A822FAQ3 | 11-134 | None |
| A0A452XQA8 | 36-141 | None |
| A0A556TQ00 | 369-479 | None |
| A0A5F4WDM3 | 15-144 | None |
| A0A7R8H1N3 | 9-142 | None |
| A0A5K4F7P0 | 2-127 | None |
| A0A674HGJ4 | 101-231 | None |
| A0A6I9MR14 | 10-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.