DPCstruct | MC25063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 50.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1W0R6 | 1-124 | MENCKMVFQVLLGNTIIIDNLEAAIQYRREVVKMTDCPTLLTREGYRIRSNGKFGGLSNKAPPIEKLRGMVFGEPLPPDYNIVCLQI… |
| A0A433UCY6 | 197-292 | QSCKIVFGMLLGDTLILDTLDHANLYRQELVKYTHCPTILTRSGDRIRSNGKFGGAMNKAPPIDRLKGCVFGQPLPIAYHAVCTQIE… |
| A0A3B3XJQ0 | 221-349 | None |
| A0A3B4AQM5 | 264-384 | None |
| A0A7M7N1I8 | 682-770 | None |
| A0A3Q2EBK3 | 416-552 | None |
| A0A2C9KW83 | 74-199 | None |
| A0A2G9NGR5 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.