DPCstruct | MC25061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 67.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146MBN9 | 136-241 | VVKNLRSMIMDELESALAQQAPPPVQEDPSLYELPPLIIDGIPTPVEKMTQAQLRAFIPLMLKYSTGRGKPGWGRESTRPPWWPKEL… |
| A0A6J1VY05 | 1-107 | MLRYVRKYKSMILEDLESALLEHAPAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDI… |
| A0A2R7WBB0 | 5-110 | None |
| A0A4Y7LTJ9 | 2-110 | None |
| A0A674DAC0 | 150-253 | None |
| A0A6A4VBA3 | 140-245 | None |
| A0A1D2N4E5 | 135-240 | None |
| S4R9R6 | 1-115 | None |
| A0A8B6D8U1 | 3-80 | None |
| A0A5N4DYW9 | 143-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.