DPCstruct | MC2506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 241 ± 28 aa |
| Standard deviation of domain lengths | 27.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183A0V1 | 1-245 | LTGLDLWDSLIRVAQASNEASGEVVGQAVACCTKAILWHIARLSESDADKTEISKVRRMINLFMEIAIGYLDNPSKRLSYESFLSVC… |
| A0A437BLM0 | 36-253 | LHYTHTRARLQAYTAVCRQLVRDGPPDHRQEAYVSLCDLLILFSEQLAVQNPGEKALRELVLEAEPSLLDDLNHFIQDVVFVNHNYD… |
| A0A6I9PA71 | 2-238 | None |
| G3NBB0 | 17-229 | None |
| A0A182X5X7 | 2-267 | None |
| A0A822GKY1 | 346-645 | None |
| A0A0T6B1T9 | 32-289 | None |
| A0A7J6Z2V5 | 67-339 | None |
| A0A183EDD5 | 1-204 | None |
| G3I5G1 | 3-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.