DPCstruct | MC25058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 194 ± 24 aa |
| Standard deviation of domain lengths | 24.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8LRW1 | 9-217 | SVVKVTCFLLILVVQTLVSPCNKTQLTRTCQSVMYDCGLLGKLCNVVMVNGVPVDVLTKAIYALADSIRGYPQSQEFLAKLVAPADP… |
| A0A0C2F944 | 42-242 | ANIIFLLQVIRSLVSPDNSVTNTHAAQKALHQTKMLAELCRVLLSEMGLPVEVLTETVIAVAEAIRGNYTNQEYFASTSLITNENVN… |
| A0A5J4NC65 | 216-419 | None |
| A0A817QJG3 | 57-257 | None |
| A0A814TGF9 | 2-177 | None |
| A0A820U8J5 | 4-156 | None |
| A0A834EY87 | 273-464 | None |
| A0A7R9A8D7 | 286-501 | None |
| A0A4Z2DU56 | 223-400 | None |
| A0A419PL46 | 209-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.