DPCstruct | MC25057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8ZNV7 | 19-120 | AAAIRAAAVSALARFGALCEDLLPNILVLLSRCMMDDDDEVRDRACYFHAVLEQHNKALNLQYILEGLQVSLSGLERALSAYTLSPS… |
| A0A3P8LQI6 | 1-135 | MGPPIKCTATTALARFAAHNDELLPGILVLLKRIMIDEDDEVRDRAAFYHYILSTNQPTLKSAYLLSEEMHLSPSGLERALLDYVHD… |
| A0A674IGP4 | 7-123 | None |
| A0A3Q0CS22 | 4-125 | None |
| A0A1I8C8E8 | 740-862 | None |
| A0A0M3J817 | 2-98 | None |
| A0A2K5KKG8 | 80-193 | None |
| A0A2H2ICR9 | 191-317 | None |
| A0A817W9R8 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.