DPCstruct | MC25056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 97 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 56.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FY22 | 72-169 | VTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVLMRHDIPDLGTVSEAKPHLIIHGFSSRLGKRVSDILRYLFPVPKDDSHRVIT… |
| A0A3P8LGX1 | 1-87 | MIISHLPFGPTAIFTLFNVRTRHDMETMGCGSGAKMPQSYPNHIFKGLNSKLGQRVRCILKHLFPVPKDDSKRVVTWYEEADVICFR |
| A0A1V9YWR4 | 135-231 | None |
| A0A5F9DVV9 | 114-203 | None |
| A0A7J0FXH6 | 134-233 | None |
| A0A2G5D6A8 | 175-272 | None |
| A0A3P7GEI5 | 4-85 | None |
| A0A0E9NC87 | 1050-1148 | None |
| F0W589 | 632-728 | None |
| A0A834Z438 | 134-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.