DPCstruct | MC25055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 38.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2NDT0 | 8-169 | AIDMYGHDFHPENLQKLIMSETSIFDVLHDFFYHPNEAVRMAALEVYVRRAYTSYELTCLQHQQLFSSLCIVQFQFLLPSSHPNRIP… |
| A0A1Q3EN13 | 144-315 | KTVLRSFTSQYYGEQVNTVHTPSAEVLRELSDSRYTVFDILSAFFEHEDHMVPLAAFEVYIRRAYKAYTLLSTDYEEGDELDDGDSP… |
| A0A2T6Z9N3 | 2-130 | None |
| A0A2G9SEX8 | 341-504 | None |
| A0A180G2Y5 | 256-411 | None |
| Q13085 | 1107-1283 | None |
| A0A818C258 | 335-496 | None |
| A0A512UM59 | 307-477 | None |
| A0A2I0TMN1 | 118-273 | None |
| A0A821R3B0 | 119-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.