DPCstruct | MC2505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183A0K1 | 1-72 | MILRFAVENNGVVVSNDQFRQYRDLGDEFRDVIDNRLLQYTMALNTFLIPDDPFGPNGPSLDECLRIPKPTV |
| A0A6J0B7V7 | 470-535 | RYILEYATMCDGIVVSLDQYRDLYAEKPEWKNTIENRLLVPTFVGKCVMFPEDPLGRRGPKLEEFL |
| A0A834BM81 | 72-146 | None |
| A0A1S3JFS5 | 857-931 | None |
| K1PRG6 | 419-498 | None |
| A0A0B1TM60 | 33-113 | None |
| A0A7E4RLD8 | 44-115 | None |
| T1GMT0 | 16-90 | None |
| A0A5S6Q8J7 | 177-261 | None |
| A0A2B4SHU1 | 365-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.