DPCstruct | MC25046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N6BE79 | 1-105 | MTTEELIKRNTILQRSLTRENAVAYEIVLAYVRGSNVSERATEETLLEIIEHLITGQKHGKKAEDLFGRDLKQYSKDIVANLPKETK… |
| A0A7I0FBN0 | 2-94 | RDKLEDANKDYYEKLLTYIRTVEFFYDEDEIESLLYAILSDIVLAQEHGEAAADYLGRDPKEMADSLISKLEKPKFQTKLKLSGYIV… |
| A0A0R1ERN4 | 1-107 | None |
| D6S286 | 4-106 | None |
| A0A6A0BD41 | 9-107 | None |
| A0A1H9R5Y5 | 8-103 | None |
| A0A4Q0VHQ0 | 1-108 | None |
| A0A822VFW8 | 1-108 | None |
| A0A2A5SDT2 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.