DPCstruct | MC25045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 11.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E8NMR0 | 42-151 | DQNLANAKTDAVAEIDDLQHLADDKKQSFVDQISNADTVAAVEQIVSDAKLADELAQQQAEAETQIDEMVYLSDDEKASYKDRVANA… |
| A0A5E9HXN1 | 160-277 | VADDRSLEVAKEEAKVIINDLSNLSDDEKSNYTQQVDNSKTVEEVNSIVLDAQNKDRDNAKAKLEAAKEKAKEQINNLPNISDSEKE… |
| A0A1E5KWR2 | 606-713 | None |
| R2SE49 | 20-148 | None |
| A0A0C5RC45 | 146-257 | None |
| A0A0C5RPX5 | 167-267 | None |
| A0A0C5S240 | 19-167 | None |
| A0A1W1UW16 | 292-407 | None |
| A0A8A6QGD5 | 165-280 | None |
| A0A8A6PC30 | 217-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.