DPCstruct | MC25041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 79 ± 2 aa |
| Standard deviation of domain lengths | 1.88 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13665 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9JZW1 | 1-77 | MQETVSINGLTLCHNHSDGWVRSTLPDLCKSSDKPVPYTNAAYARDLANGTTTVFSHGGAMNGITGSEFYRSFGDEP |
| A0A447LYX3 | 1-76 | MITININGLTLCHKGSGGISHNTLPDVCKTPPFGVPVPYENEAYSADLIKGTTSVFADGGNMIAHVGSQFARSVFD |
| B6ER37 | 1-79 | None |
| A0A1M7P3W3 | 1-78 | None |
| A0A380Q3W7 | 1-76 | None |
| A0A7T0DUR3 | 1-78 | None |
| A0A812FNF1 | 1-79 | None |
| S5MVE2 | 1-76 | None |
| A0A849YVU2 | 1-80 | None |
| B5EVY9 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.