DPCstruct | MC2504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7TY68 | 667-820 | GQEKALVLHDILEAVERERMRKMQRKFTHMSSSRSVHRALNQMRAISASHDEDKRMMKQRVSHIYQQWYLDIDHAIPDEIKQDWYFT… |
| A0A182ZZI5 | 2-155 | RPRICLGKYRSIATQAPSHQALQRLHQEASYNRAVHELAYQYAERKQLAAWYSDLINDLSEIQTDEKIAPLLKQLIPYAQLSASQFT… |
| A0A094ZQ88 | 75-241 | None |
| A0A2G8LD29 | 197-355 | None |
| A0A7J8GWX4 | 197-384 | None |
| A0A074ZXZ2 | 55-215 | None |
| A0A267ETM5 | 16-173 | None |
| A0A183JEL1 | 2-162 | None |
| A0A8B6G443 | 155-317 | None |
| H2XRH8 | 35-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.