DPCstruct | MC25033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 8.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 71.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8PQI0 | 66-131 | IALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNNKEIKKRAYVCPEPTCVHHH |
| A0A7J7FY15 | 1-80 | MATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVKKVYVCPEATCVHHEPSRALGDLTGIKKHFSRKHGEKK |
| A0A453KYW3 | 6-91 | None |
| A0A833V8L2 | 14-79 | None |
| A0A2I0KK39 | 1-72 | None |
| A0A445IH88 | 1-87 | None |
| A0A803QJL7 | 3-66 | None |
| A0A5P1F3W5 | 3-66 | None |
| A0A5D3DE72 | 1-68 | None |
| M8BTJ7 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.