DPCstruct | MC25032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 297 ± 41 aa |
| Standard deviation of domain lengths | 41.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 53.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9H0Z9 | 1-260 | MGYPSKTILYLAGSQTFGGQRLLIPLRAMFANLVDRTSLCSKTELSDLVGPETPLPSDIFQLPRPKSESEIKEEWSRAGPRPRPLPP… |
| A0A7J8PPC3 | 2-291 | FANLVDRTSLCSKTELSDLVGPETPLPSDIFQLPRPKSESEIKEEWSRAGPRPRPLPPPPERRIYPHEKEGWYGWITETDKEPNPSP… |
| A0A445B6E4 | 2-323 | None |
| B7ZZN8 | 39-359 | None |
| A0A392MNS7 | 3-208 | None |
| A0A446JL90 | 345-664 | None |
| A0A834ZBX5 | 114-442 | None |
| A0A314US68 | 343-689 | None |
| A0A540MN90 | 68-397 | None |
| A0A4S8K1M8 | 676-1002 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.