DPCstruct | MC25031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 155 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0GF16 | 1-160 | MAMEENESCGSRAADSSSPTKRTRQNRERLSVFNEVLSRLQHLNHEDAKLPGFEDQLWLHFNRLPPRYALDVNIERAEDVLMHKRLL… |
| A0A7J8PM23 | 1-159 | MAIEDDAESCGSRAVDSLVHVNPRHHRQKLDVFHQVLNRIRHSNYAEANLPGFDNHLWLHFNRLPARYALDVNVERAEDVLTHKRLL… |
| A0A314YRG7 | 1-140 | None |
| A0A1U8EER4 | 1-149 | None |
| A0A059ART9 | 6-137 | None |
| A0A438K5G3 | 45-182 | None |
| A0A287S313 | 56-234 | None |
| A0A5B6X729 | 1-158 | None |
| A0A1D6IA61 | 1-162 | None |
| A0A4S8JI54 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.