DPCstruct | MC25030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 228 ± 28 aa |
| Standard deviation of domain lengths | 28.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0123- CL0208- PF01448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7A3V7 | 1-163 | MSTHSSYSCLMDDDDYEKKLMGTCVIPMPDLESPAFNCSLDGGARNNCNCLDGGSVRCVRQHVMEVREKLQADLGQKVFEELGFCDM… |
| A0A7J8PLD4 | 2-235 | KQLHLGKMASKGLDWSQSSSFGNHSHLNNSILSVDKNLRECSDFTTSSLMFNYNVDIQVPIGPLFQAEVLEWTGVALESDAKWLGTL… |
| A0A7N0V001 | 572-811 | None |
| A0A1P8BB88 | 327-539 | None |
| A0A072U022 | 232-463 | None |
| A0A7N0U624 | 361-564 | None |
| A0A6V7PNG3 | 1-158 | None |
| A0A835HLP0 | 358-603 | None |
| A0A166DC08 | 1-215 | None |
| A0A4Y7J862 | 246-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.