DPCstruct | MC2503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 80 ± 3 aa |
| Standard deviation of domain lengths | 3.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5HS43 | 37-115 | FVAPFKRDRMTWIKPSFLWMMYRCGWATKPGQERVLAIEITREGFEWALAHACLSHYDRNMHGDRANWSRQLRSSPVRL |
| A0A210B191 | 35-117 | RFGSPFSFNRMTWIKPSFMWMMERSNWGMKKDQQRILAIRIKRTFFDTLLEQAVLTTPEAHVYPHAGVWETLFAQANVYVQWD |
| A0A250G2Y6 | 167-247 | None |
| A0A3N1A4Y4 | 42-122 | None |
| A0A375I2C3 | 3-76 | None |
| A0A0Q6WF22 | 59-143 | None |
| A0A838EP19 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.