DPCstruct | MC25029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 181 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2QBQ7 | 3-174 | WELLVSFSPFFFVLLAFVAFLLWNGSVVLGAKEAHAVSPHFAQIMYFSIVSTLFAAPLHFTIGHALDLFQSFWKNRLLGFLLLFLAS… |
| A0A7J8PFQ5 | 109-250 | LVSFSPFFFVLLAFVAFLLWNGSVVLGAKEAHAVSPHFAQIMYFSIVSTLFAAPLHFTIGHALDLFQSFWKNRLLGFLLLFLASIAS… |
| A0A0E9NLY6 | 221-403 | None |
| A0A812JK71 | 415-597 | None |
| A0A6C1E7E1 | 864-1043 | None |
| A0A0M0K968 | 136-290 | None |
| E4XPR0 | 1-203 | None |
| A0A5J5UGB0 | 94-295 | None |
| A0A093XS45 | 1-188 | None |
| A0A165A4M0 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.