DPCstruct | MC25028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 66.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 63.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072VTL5 | 177-282 | VNKNLVGANCLTTDQKKKLLWGSKKSTPTEESGHRWDMAVFDPERQEKFNKLMGVKGEAKVEQNSDNQNDNDLLRAEKQKELQLDLE… |
| A0A7J8PF48 | 1-90 | MTTEQKKKLLWGSKKSTPAEESGHRWDTALFGDRERQEKFNKLMGVKGDVKVEHKADNQDAEKQRELQLDLEKQYTAGLRRRDGRTV… |
| A0A7I4AYI4 | 240-341 | None |
| I0Z5G7 | 270-377 | None |
| A0A2P5AR97 | 383-478 | None |
| A0A5A7NY52 | 144-245 | None |
| A0A7C9FFS7 | 31-132 | None |
| A0A251SBE1 | 242-330 | None |
| R7VZD0 | 273-369 | None |
| A0A835QBD3 | 404-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.