DPCstruct | MC25027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01933 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6X5L0 | 78-143 | SVRPLAAINLIRSLLKVDAHLIPMSELPVDLMAIDAQGHEVYGEVNIDQLTVPPQELMLSPKVPTT |
| A0A854IXT4 | 1-61 | NLVRSLLKVDAALIPMSEQPVDLMAHDHEGNHVYGEVNVDQLAHMPQELMLSPPVSATREA |
| A0A2X1SSD6 | 108-180 | None |
| G6EMC6 | 1-75 | None |
| A0A484WPQ9 | 18-77 | None |
| A0A6S6RX52 | 1-53 | None |
| A0A379S5X5 | 9-70 | None |
| A0A3S4I7R4 | 1-51 | None |
| A0A379TGK7 | 29-90 | None |
| A0A376JBL5 | 87-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.