DPCstruct | MC25023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 156 ± 14 aa |
| Standard deviation of domain lengths | 13.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3QIR7 | 291-437 | TVAYAEQWKMGQLQPGDRITFQRITADDATALEASQDAFVRSLHLPETISAPTTIKTATSTSPDTPILHTIPEAGEQVQVVYRQAGD… |
| A0A0C9UWZ8 | 256-396 | ASGDLWKVGQLSPGNAVTFNPVSWVEAQACIETAKLWLADIESVVSGSTTVVPRATLGITSTHWHHPSCILFKHEPRPESSRPVATF… |
| A0A4U0UCI2 | 370-527 | None |
| A0A7D9IDP1 | 720-863 | None |
| A0A821DP17 | 1-181 | None |
| A0A817GY31 | 772-933 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.