DPCstruct | MC25022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5YDC6 | 131-250 | SYTKNGVTQLRLVRASKDCSELPAVVECWCVFCKEHTKLSKAQSMNNAIDANPQWTNGARPKYISRLFYCSNCSPKTHRFVPVNETI… |
| A0A1V6R616 | 368-478 | EEKSLDQFDKWFLLRREEFGALPVELEVRCQGTACQETKTVKARWTGHATPRFVVAVHPCIKSGLRTDWIPTGYPTIHSANLSRLWK… |
| A0A2T3Z7C1 | 1-141 | None |
| A0A2T2NBC7 | 668-795 | None |
| A0A4Q4VGJ2 | 247-371 | None |
| A0A2J6SB73 | 474-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.