DPCstruct | MC2502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0ABV0 | 24-159 | ISPVVHRQLLPAGPAYLAHVQRAINKLSFEEYDQQVEEEQKRLDALQADGLNGEDDLGVGDEEESPELLLLDPKEWKKQDHYQVLGL… |
| A0A3Q3E5A4 | 13-160 | LASVQVQVEPVGRWFEAYVKRRNRTVSTSFQELEEEEESSEESDDEDFQLEEHPMLRTLDPKDWKNQDHYAVLGLPHLRYKATQKQI… |
| A0A6A5DAK0 | 2-107 | None |
| A0A183RLY3 | 1-129 | None |
| A0A7J7JFB7 | 13-165 | None |
| A0A3P7M6M9 | 1-120 | None |
| A0A4T0R322 | 385-518 | None |
| A0A146IN21 | 274-397 | None |
| A0A5C3KKD7 | 323-476 | None |
| A0A4T0IYN9 | 420-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.