DPCstruct | MC25012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 16.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0TW85 | 53-174 | NYWKNRVLPFLETIWPKSKDKTLINHPESFALLCIAAGYEFPSAVKKVRGYLQVIPEPYYVIHRLHQSGLSDNFPKDVLLLLSIIVS… |
| A0A6L9JI91 | 1-146 | MRNDGWRLSSKDEPDNKFFLQWRDLIIQFFTHVWPRQKAIKSPETTENISRLLFSQETMFPKLVDIVMPFLTCTNNGASLMYYIKNE… |
| A0A512BZN1 | 202-326 | None |
| A0A7H2ZT39 | 10-143 | None |
| A0A562NV05 | 376-505 | None |
| A0A0Q4G599 | 417-595 | None |
| A0A0M6ZMP9 | 505-624 | None |
| A4U422 | 1-126 | None |
| J2GRX2 | 695-815 | None |
| A0A0F2RDE2 | 679-802 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.