DPCstruct | MC2501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3DQS5 | 4-97 | SRRDVIDFSALEKDLRASVEAELKYRRENDAKLRAVQQGVASYQQFRDLVLTSHLTPLHKTDKNARKHAPWNPVVATGNTPDPQEQH… |
| A0A2R7WSJ9 | 19-95 | LVDMSRLAEDAKRAVEEDKLYWLRNSTKIRAATTGTPDYETFRQLVEAAHLRPLEKKDKVDRADQKTVWNPIAKKNE |
| H2MFU1 | 2-95 | None |
| A0A6L2Q3E9 | 49-146 | None |
| A0A5C6MH32 | 14-104 | None |
| A0A6B0RAN4 | 7-89 | None |
| A0A812TH20 | 8-94 | None |
| A0A183NGB3 | 10-105 | None |
| A0A7N8YLZ1 | 2-90 | None |
| A0A4W6EZ68 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.