DPCstruct | MC25009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 153 ± 11 aa |
| Standard deviation of domain lengths | 11.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2TN51 | 1-155 | MNNVLMIPIHLDALYLKSDRLVVEAMADFSRLPHQDQRDVNPNIANISEEIVSQPFQNQNLYLKAGIHLHWALPDALTKGIQTQDNN… |
| I4I4C1 | 2-147 | VNSILMIPIHLDALYLKRERLVVEAMADLSIIPYFNRKRDVNPNIAHISEEIVSQPFQNQNLYLKAGIHLHWALPDALTKGIQDSDK… |
| A0A1V8M7T0 | 2-154 | None |
| S9QDL1 | 1-142 | None |
| A0A2R7SI27 | 6-172 | None |
| A0A845WPP1 | 8-167 | None |
| A0A846CW71 | 8-165 | None |
| A0A1C6RV26 | 3-162 | None |
| A0A3R6RFA8 | 1-151 | None |
| A0A552L848 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.