DPCstruct | MC25008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09522 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O25246 | 1-154 | MIDYAKQLGLISLENLENTLKYLKKQKQFIEDNFMITRERFRSHQFGGMDFELSRISYPLLIHSFDDNELSEIVIREQQYGSKTQAM… |
| D9Q019 | 27-168 | CLDKALNNDTNLKMEIKRVVEEYRNVDTFDKKFTIQRIEDNRYYNEFKLINELTPILRLDGLTDNYYIDIILKPKQRAVGYQAMVFL… |
| A0A1M6W0D5 | 48-205 | None |
| A0A7J4KKD1 | 42-206 | None |
| A0A497RJ69 | 1-128 | None |
| A0A2H9QQL3 | 133-285 | None |
| A0A5M0Z9H2 | 2-134 | None |
| A0A692SR37 | 95-224 | None |
| A0A7V4IIZ7 | 132-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.