DPCstruct | MC25006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 273 ± 39 aa |
| Standard deviation of domain lengths | 38.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 64.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1CE06 | 60-287 | LLKQVIEHTHYLPTEWKYRLHTDQVRAEFCLLFDYKVGLFFQELLSVLFAPLVLCFSLPKSADQIIDFFREFTVHVNGLGYVCSFAQ… |
| A0A077ZQ55 | 44-278 | ELLSPIVCPFVLLLWLRPSAGQFVDFFRNFTVEVSGLGDVCSLAQVDLRNYGDPTYQMANKPLSKEASMAKARHGKVEMSLLHFIST… |
| A0A0N5BKE0 | 471-771 | None |
| A0A7E4S3W6 | 2-222 | None |
| U4U256 | 418-682 | None |
| A0A7S1ZUG3 | 246-503 | None |
| A0A7S2GRF2 | 20-245 | None |
| A0A4Z2IWV8 | 8-323 | None |
| A0A6P5JJJ9 | 300-615 | None |
| A0A7J7WFH9 | 1-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.