DPCstruct | MC25004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1NPG2 | 2-101 | CGRAMRCEGTGVVQLRHHGKGLIEVEVIVVRSKPLGYDLILGMNGIAALGGVTVTGGRCVRFGLDDPGVCAAAEAGISIRERDFTAT… |
| A0A085MYR0 | 38-138 | TVSGGQLQCIGMGSVKLQLLQGGQVPVEAVIADKKPLGFDFIIGINGISPPGDVMVNAQGQVHFGTEGDIVVASADAGINVEEKDFV… |
| A0A5S6QS42 | 1-108 | None |
| A0A085LYQ7 | 1-104 | None |
| A0A5B7JKK3 | 1-99 | None |
| A0A5S6QTL2 | 36-140 | None |
| A0A5S6QHX4 | 2-91 | None |
| A0A6A4X4X8 | 194-291 | None |
| A0A0V1LHR4 | 1-97 | None |
| A0A085MZB4 | 36-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.