DPCstruct | MC25002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 663 ± 53 aa |
| Standard deviation of domain lengths | 53.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.87 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0673- CL0392- PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RVE3 | 1-566 | MLTQKIAAHIADFTPRLWSNNKAQYQYIVIPVVKYPQLLNELFCNIFYLRHLCDTTRFPDWPINDPVSVLRDVLEAWTGEVEKKPPV… |
| A0A077ZJH8 | 14-653 | WTTGNLMARELLQRIMPEGLLLYLNSTDRAPPLDNDLSLTRCNSDVNDKNYDKLSDQKENLVVDRLIHVRKAVENQLDFLFQHWFHR… |
| A1Z7S0 | 637-1335 | None |
| A0A368FDJ1 | 102-782 | None |
| A0A182EI93 | 348-936 | None |
| A0A6A5HJ95 | 1-679 | None |
| A0A3P7DLK6 | 633-1319 | None |
| A0A1B0DCK4 | 475-1153 | None |
| A0A397B5F9 | 1-762 | None |
| A0A3P7SF78 | 107-749 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.