DPCstruct | MC25001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10204 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1T9D2 | 126-246 | IYTRDWHSAEVETVTAYAPFDRREVHAKVGLHVGLAGINVTLKGVPEEQIGQIINYNEEFDWATPDRSSFFQGRIGFGRYSNLLNRA… |
| A0A077ZJ23 | 7-117 | DGANTSHWCLDLKSFSSERVLGILGIHIGLSCANITLQGSTEKNSHEFMNYNERIYFTDVKTIHRNLLDSLHKGLPYPIITVIEYLA… |
| A0A6L5CE62 | 212-326 | None |
| A0A2T7PRR1 | 282-385 | None |
| A0A6L5CDB8 | 190-313 | None |
| A0A3P7AJZ1 | 55-166 | None |
| A0A6I9ZEF2 | 2-105 | None |
| E4XVV8 | 71-177 | None |
| A0A1I7YX94 | 77-185 | None |
| F6REW6 | 73-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.