DPCstruct | MC25000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077ZGN6 | 852-956 | LVQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVI… |
| A0A7C5S2I0 | 26-129 | KIEFLREICSAALSKNAQDIVVLDVRECVSYTNHIVICTGNSDRQICAIADEIERSAMKFSERPLSVEGYERGYWVIVDFVDTVVHI… |
| A0A136K0Q2 | 23-132 | None |
| A0A2E8KIE5 | 72-186 | None |
| A0A0D9XY44 | 29-124 | None |
| A0A7R9LY35 | 4-82 | None |
| A0A7C2A815 | 6-104 | None |
| A0A845D7X5 | 200-306 | None |
| A0A6J5W391 | 1-123 | None |
| A0A0D8X7M1 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.