DPCstruct | MC250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2VEE6 | 59-168 | LSMDQLTPSPARTPARQATVVWFHRPVMVGRQILQGQYVIEHDNDRMARGEPCTFIYAFDDRTKPVVTFHCVHLDRPPSTAGNVVLA… |
| A0A2V9W1T0 | 8-118 | TLVFILAFMSSTGTFAKDKNRHTVEISDSLQVGSTQMKPGKYDVQWQGTGPEIQVSFVQNGKTVATVPGTLKTNDPHVTEDDIVTET… |
| A0A7V8NLL1 | 6-171 | None |
| A0A7V8NQX8 | 37-147 | None |
| A0A7G8BHP2 | 5-116 | None |
| A0A841JZV5 | 88-211 | None |
| A0A2V9T464 | 15-129 | None |
| A0A7C2MAP4 | 2-103 | None |
| A0A090MGG1 | 12-139 | None |
| A0A317H677 | 16-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.