DPCstruct | MC25
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 196 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 14.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S6FK88 | 240-411 | RAPMWRYGATGSVGLAQFKFIDSASLSERAPNKPQFKVAAFGAWYGADGVSAVLLGAEYQNAFEAAEDALVCKPVVVDPEEDCTTGA… |
| A0A0Q8ZRA4 | 1-215 | MNFNASYAFMKEISGKDYFLNFQSAYNIEKSTMYYPDEIYEDQIHNFNFSGAVFNVSVSTLFKGFIFPTLTFGYARKNNYADLDKIE… |
| A0A3A8QZ86 | 146-343 | None |
| A0A554VFD7 | 275-481 | None |
| I9C035 | 309-477 | None |
| A0A4Q6BY97 | 105-308 | None |
| A0A3D1P5M1 | 1-235 | None |
| A0A7K1TBA0 | 141-341 | None |
| A0A7Y3W5X2 | 262-429 | None |
| A0A7Y6Q184 | 310-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.