DPCstruct | MC24998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 212 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077ZF13 | 1-201 | MIHQYSNVTLDELILVALCKDTGRTKVIMHMRVHIRNCQKNSPNSCKSGPPISAYCSWIGRLNGTAHRKLDGAVCYITEKISEEEEW… |
| A0A0V1DYB8 | 108-270 | LNELIQVQQPGKPYYTVKKVLTAEFCDASTIAFSIKIKKTTCSVSQVFSRASDDSDCEMTKSKSLPCMLLVKGSRYSISSLLAAVCD… |
| A0A1Y3EXV5 | 15-212 | None |
| A0A077ZK03 | 58-272 | None |
| A0A085LKW4 | 137-352 | None |
| A0A077Z490 | 159-387 | None |
| A0A085NK36 | 332-542 | None |
| A0A085N3Z8 | 85-325 | None |
| A0A0V1AVI5 | 663-888 | None |
| A0A0V1NTS1 | 119-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.