DPCstruct | MC24996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 162 ± 33 aa |
| Standard deviation of domain lengths | 33.22 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3MIJ2 | 2-117 | DLEEELLEIYKNLDNNLDEALKNLENFLKTDYDQILSSLNPVSRAKFELLLAYIMSSIYSIFLKLEGTDTGTHPVKEELNRIRKGMQ… |
| A0A077ZD54 | 1-160 | MDENSRIDKYVDLHKMVDELQELVQRYTEKPFVDRMTEQSNLQNARTNVELMYVVNALFWCQLRLQNCDAAKHPIMKELNNIKQKLN… |
| A0A2K5Q5J4 | 4-130 | None |
| A0A6A4JUZ9 | 43-179 | None |
| J6F802 | 79-244 | None |
| A0A7R9A435 | 12-145 | None |
| A0A4S2N639 | 8-179 | None |
| A0A834Y177 | 1-127 | None |
| A0A1J1HA16 | 19-145 | None |
| U6KUB8 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.