DPCstruct | MC24992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 95 ± 23 aa |
| Standard deviation of domain lengths | 23.28 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077Z1C0 | 1-116 | MEVAQLFKIVMNAGEWIWKKYLMKSELGLLPKEYNKKIHGVYCPWRYYGKKDINFFDVKLGDLPAWYARRDKSFKAFRAAIGRGLNG… |
| A0A6J0BDK0 | 2-107 | GFGDYPAEYNRSIHGPYDPARYYGKPDTPFGQVKLNELIPWLSRRNKSPRAMVAAVSRAWWRWQHKYLHVKRGGIAPFFQITTVAMI… |
| A0A443SMS6 | 4-111 | None |
| A0A0B2VLA1 | 86-216 | None |
| A0A3M7RNZ4 | 5-97 | None |
| A0A1I8M220 | 1-56 | None |
| A0A6L5CHB9 | 3-103 | None |
| A0A044R077 | 43-164 | None |
| A0A183VSP8 | 27-131 | None |
| A0A816ZC33 | 88-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.