DPCstruct | MC2499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 173 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2ZJ23 | 27-198 | SNMIRLLFLACLYQQLAVVSSGQRDDMNGHKGAKMVPLRPFRGRDKRGCSWAAAGEGHDITLVVTCADRGSASICEYTATPSSCPGY… |
| Q4T4N8 | 2-158 | EARIRALLLFFAVVCASSAQTNHSLWDEPIRFSTKAKDSCSMLVSTAGDYTRLRVSCKGPSQGQNPGRSYSCDFQGKPNLCRAYAAN… |
| A0A3Q2LU78 | 10-196 | None |
| A0A6J2D773 | 11-188 | None |
| A0A087YRK7 | 1-156 | None |
| A0A5F5Y6S4 | 1-207 | None |
| A0A667HM86 | 1-163 | None |
| A0A4Z2G5T8 | 112-270 | None |
| A0A5N5NWR8 | 5-164 | None |
| A0A444UHU2 | 51-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.