DPCstruct | MC24985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9DGU2 | 63-219 | ELTMDDPSEFAMVKHRLLTQPTFLQVTLKKEKKSGNTRYITRGNFVIFLNNTHPFIQQQLREKLDQCEQLLSADKNFALEIDLGPAL… |
| A0A2C9L0Y8 | 49-207 | RRSYCMERKNEIDDFRHEILQRPLVLQPVLHFGRGFGHYCGLCYSDEPWVILINQTHPKILSRLQMGLDMAKAAIERGQAVEVRFEF… |
| A0A3M6UUD1 | 78-230 | None |
| A0A210PR31 | 62-226 | None |
| A0A6P7TQA2 | 1-147 | None |
| V4AFF8 | 2-170 | None |
| A0A7I8V6B9 | 67-227 | None |
| T1EZQ2 | 1-175 | None |
| H2ZQ01 | 54-180 | None |
| A0A3Q3MB92 | 88-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.