DPCstruct | MC24983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849GGG9 | 1-100 | MACEYPSRIDVPNGISATRDDMISGQKQVKEYVATMEAYLDCIVADEKSNRADMDSLSAEDEQLREEMLNKKYNAAVEEMERVAAEF… |
| A0A381UPX8 | 1-110 | MCTLRYVMILAISFVGTSFACEYPPLVAVPSGEDATMEELLAAQAQIREYMTAMEEYLVCINEETEAAGDNAPEVYGQIMAERHNSA… |
| A0A1Z8X7Y6 | 22-129 | None |
| A0A523MJQ4 | 1-110 | None |
| A0A6L8B9W9 | 71-179 | None |
| A0A6L8EM79 | 5-125 | None |
| A0A6N7JFG2 | 67-167 | None |
| A0YA01 | 14-128 | None |
| A0A501PN50 | 2-114 | None |
| A0A2E7IPD3 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.