DPCstruct | MC24982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04200 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q98QD0 | 24-139 | QLAFISCTTQISQNQKVKILKNELDSIDKIQLVASSNLKNKLASEVEVSDLKKENFQLIKSGKNYNLASDFMLSYELSKENMNSNDE… |
| A0A858U5K7 | 1-98 | MWWNQKEGSKPNNPSQKDVQDSLNNVTVTVVDKNKLASAVKIADVTINGKANGFTYVIESIIPNDTAGELAIKVKSSKGDISATKDL… |
| A0A168RH62 | 629-726 | None |
| A0A063YN44 | 1-120 | None |
| A0A4P1QG08 | 1-126 | None |
| A0A4P1QGJ0 | 3-106 | None |
| A0A3A5JAZ2 | 1-123 | None |
| A0A449AMY0 | 144-226 | None |
| A0A2Z5IRA4 | 2-113 | None |
| D4XW94 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.