DPCstruct | MC24981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 241 ± 21 aa |
| Standard deviation of domain lengths | 20.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7DXZ4 | 32-274 | HDFINNSDGYKALVTSCDKIISTGQYMAGTLIEETTTYPNYEGYPVKLYEYSTGKDVQTGVQKKGKVYMLNPTAEKLATWIATAVWK… |
| A0A1B4YE18 | 37-286 | SEPDVVAHVEANLARYMMEQPERCTTATKEVEQNEIVAPYVEALAKAGSSADGARIAECTYEYSPMDGGAKQEGYAILLDLPASVIG… |
| R5M7V6 | 217-459 | None |
| A0A521TF90 | 29-317 | None |
| A0A1Q8IKF5 | 228-439 | None |
| W0F3D2 | 5-233 | None |
| A0A6B8LVV8 | 23-243 | None |
| A0A5P6P7B1 | 236-495 | None |
| A0A414ZBX2 | 390-623 | None |
| A0A7W8QXP1 | 848-1076 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.