DPCstruct | MC24970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 131 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0B0E8 | 108-244 | NELVRKVVMTKKIHYFRNKINKAPKTLEELLKEKENWILVPPHKSAYHMHGIDGILNLKFVSKKGGHFESIYDKDNNLVTNKENMGT… |
| A0A2T6E527 | 2-120 | SRHYDLATYSSADLDDPDFKLKAAFIYTVLYNTTEVWTHRMNGEVGNTVFIHDSGGELVFDENQQRVESCENMGSFNYAHYKREPLA… |
| R6TXF5 | 61-181 | None |
| A0A7C1WDN9 | 215-339 | None |
| A0A523LD73 | 426-586 | None |
| W6K505 | 126-246 | None |
| U7SXR4 | 90-226 | None |
| A0A1H2RY35 | 160-291 | None |
| A0A7Y6V385 | 19-132 | None |
| A0A350WY41 | 208-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.