DPCstruct | MC2497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 208 ± 50 aa |
| Standard deviation of domain lengths | 49.97 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3C4T4 | 24-210 | SELYSFDADKIKEKLRIGQMWALYGDEDVEWSDPDMPTCCGKFDVRNSSQAYTSTDSFSHLLKAEPTGSKGEYTIVPRRGEIWALYR… |
| A0A444YU13 | 18-189 | KMSVSWLNSRSNKELGPMDWIGSGFYKTCGDFTIGKREITGSLNSFSHKVRWAKGNRGIVRIFPRKGDIWALYRNWSPDWNKDTPDE… |
| A0A6A6LAZ4 | 326-501 | None |
| A0A803Q587 | 94-385 | None |
| A0A7N0TX18 | 474-717 | None |
| A0A2U1QHH6 | 370-617 | None |
| A0A2G2WX80 | 122-327 | None |
| A0A1E5UJJ2 | 191-388 | None |
| A0A7I4BI60 | 451-619 | None |
| A0A6S7I0G8 | 529-704 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.