DPCstruct | MC24969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 50 ± 4 aa |
| Standard deviation of domain lengths | 3.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 57.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5TLD2 | 1-49 | MKATGIVRRIDDLGRVVIPKEIRRTMRIREGDPLEIYTDADGEVIFKKY |
| K0B0B8 | 1-49 | MKSTGIVRKVDELGRVVILKELRNTLELPEGASFETYVDGEQIILKKYA |
| R5LKG1 | 43-90 | None |
| R7K714 | 1-48 | None |
| C3DQ33 | 1-56 | None |
| R7LQW9 | 1-48 | None |
| A0A2U3KMJ1 | 98-145 | None |
| A0A090ZL90 | 1-60 | None |
| A0A259UAJ0 | 23-71 | None |
| A0A351R4Q9 | 41-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.